PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0003s0530.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 382aa    MW: 43316 Da    PI: 5.7839
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0003s0530.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.29.9e-51151431128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppG+rFhPt+eel+++yL+kkv+ +k++l evi++vd++k+ePwd+++++k     +++wyfFs++dkky+ g+r+nrat++g+Wk
  SapurV1A.0003s0530.1.p  15 VPPGIRFHPTEEELLDYYLRKKVSYEKIDL-EVIRDVDLNKLEPWDIQERCKIgttPQNDWYFFSHKDKKYPAGTRTNRATAAGFWK 100
                             69****************************.99**************964444122455**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             atg+dk ++  +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  SapurV1A.0003s0530.1.p 101 ATGRDKVIYG-SGKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                             *********9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.15E-579173IPR003441NAC domain
PROSITE profilePS5100556.50615173IPR003441NAC domain
PfamPF023656.9E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MTENMSISVN GQTQVPPGIR FHPTEEELLD YYLRKKVSYE KIDLEVIRDV DLNKLEPWDI  60
QERCKIGTTP QNDWYFFSHK DKKYPAGTRT NRATAAGFWK ATGRDKVIYG SGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNTSDS NVSNVMGEAA QEDGWVVCRI FKKKNLNKTL  180
DRALSSSPIT ADTRNQTLSS SCNEGSLVQT PHYMGSSCKE ENEADNSARY LWPIDTAINY  240
VHHDRFMELP SLESPNSTSS LNFYQPMVTE NEGSIANQVS YPLDSGLTNW VALDRLVASQ  300
INGQTETSTQ SACFPNDPTI TYYTPTDLHH DLQLPTLHSS FSFPSNRSYY EAQDYNSEMD  360
LWNFSSRSSA DPLCHLSNTS V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-4991759170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999410.0AB599941.1 Populus trichocarpa PtVNS10 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025381.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-138NAC43_ARATH; NAC domain-containing protein 43
TrEMBLF1T1150.0F1T115_POPTR; Transcription factor
STRINGPOPTR_0002s17950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-130NAC family protein